Lineage for d1wp4b2 (1wp4 B:2-157)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 688157Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins)
    the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
    C-terminal domains also show some similarity
  6. 688234Protein Hydroxyisobutyrate dehydrogenase [102171] (2 species)
  7. 688237Species Thermus thermophilus [TaxId:274] [102172] (2 PDB entries)
    structural genomics
  8. 688243Domain d1wp4b2: 1wp4 B:2-157 [121138]
    Other proteins in same PDB: d1wp4a1, d1wp4b1, d1wp4c1, d1wp4d1
    automatically matched to d1j3vc2
    complexed with ndp, so4

Details for d1wp4b2

PDB Entry: 1wp4 (more details), 2 Å

PDB Description: Structure of TT368 protein from Thermus Thermophilus HB8
PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOP Domain Sequences for d1wp4b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wp4b2 c.2.1.6 (B:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
gaeagtltvmlggpeeavervrpflayakkvvhvgp

SCOP Domain Coordinates for d1wp4b2:

Click to download the PDB-style file with coordinates for d1wp4b2.
(The format of our PDB-style files is described here.)

Timeline for d1wp4b2: