SCOP 1.75: Domain d1wp4b1: 1wp4 B:158-289

Lineage for d1wp4b1 (1wp4 B:158-289)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
   multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry

4. Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families)
   N-terminal domain is Rossmann-fold with a family-specific C-terminal extension

5. Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins)
   Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain

6. Protein Hydroxyisobutyrate dehydrogenase [101357] (3 species)
   forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively

7. Species Thermus thermophilus [TaxId:274] [101358] (2 PDB entries)
   structural genomics

8. Domain d1wp4b1: 1wp4 B:158-289 [121137]
   Other proteins in same PDB: d1wp4a2, d1wp4b2, d1wp4c2, d1wp4d2
   automatically matched to d1j3va1
   complexed with ndp, so4

Details for d1wp4b1

PDB Entry: 1wp4, 2 Å

PDB Description: Structure of TT368 protein from Thermus Thermophilus HB8

PDB Compounds: (B:) 3-hydroxyisobutyrate dehydrogenase

SCOP Domain Sequences for d1wp4b1:

Sequence; same for both SEQRES and ATOM records:

>d1wp4b1 a.100.1.1 (B:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr
vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal
rllerwggveir

Timeline for d1wp4b1:

• d1wp4b1 first appeared in SCOP 1.73
  
• d1wp4b1 appears in SCOPe 2.01
  
• d1wp4b1 appears in the current release, SCOPe 2.08