SCOP 1.73: Domain d1wp4a2: 1wp4 A:2-157

Lineage for d1wp4a2 (1wp4 A:2-157)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.6: 6-phosphogluconate dehydrogenase-like, N-terminal domain [51868] (17 proteins)
   the beta-sheet is extended to 8 strands, order 32145678; strands 7 & 8 are antiparallel to the rest
   C-terminal domains also show some similarity

6. Protein Hydroxyisobutyrate dehydrogenase [102171] (2 species)

7. Species Thermus thermophilus [TaxId:274] [102172] (2 PDB entries)
   structural genomics

8. Domain d1wp4a2: 1wp4 A:2-157 [121136]
   Other proteins in same PDB: d1wp4a1, d1wp4b1, d1wp4c1, d1wp4d1
   automatically matched to d1j3vc2
   complexed with ndp, so4

Details for d1wp4a2

PDB Entry: 1wp4, 2 Å

PDB Description: Structure of TT368 protein from Thermus Thermophilus HB8

PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOP Domain Sequences for d1wp4a2:

Sequence; same for both SEQRES and ATOM records:

>d1wp4a2 c.2.1.6 (A:2-157) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
ekvafiglgamgypmaghlarrfptlvwnrtfekalrhqeefgseavplervaearvift
clpttrevyevaealypylregtywvdatsgepeasrrlaerlrekgvtyldapvsggts
gaeagtltvmlggpeeavervrpflayakkvvhvgp

Timeline for d1wp4a2:

• d1wp4a2 is new in SCOP 1.73
  
• d1wp4a2 appears in SCOP 1.75
  
• d1wp4a2 appears in the current release, SCOPe 2.08