Lineage for d1wp4a1 (1wp4 A:158-289)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1093870Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily)
    multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry
  4. 1093871Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (12 families) (S)
    N-terminal domain is Rossmann-fold with a family-specific C-terminal extension
  5. 1093872Family a.100.1.1: Hydroxyisobutyrate and 6-phosphogluconate dehydrogenase domain [48180] (2 proteins)
    Hydroxyisobutyrate dehydrogenase domain is similar to one structural repeat in the 6-phosphogluconate dehydrogenase domain
  6. 1093883Protein Hydroxyisobutyrate dehydrogenase [101357] (3 species)
    forms similar dimeric and tetrameric structures to the 6-phosphogluconate dehydrogenase domain and its dimer, respectively
  7. 1093888Species Thermus thermophilus [TaxId:274] [101358] (2 PDB entries)
    structural genomics
  8. 1093893Domain d1wp4a1: 1wp4 A:158-289 [121135]
    Other proteins in same PDB: d1wp4a2, d1wp4b2, d1wp4c2, d1wp4d2
    automatically matched to d1j3va1
    complexed with ndp, so4

Details for d1wp4a1

PDB Entry: 1wp4 (more details), 2 Å

PDB Description: Structure of TT368 protein from Thermus Thermophilus HB8
PDB Compounds: (A:) 3-hydroxyisobutyrate dehydrogenase

SCOPe Domain Sequences for d1wp4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wp4a1 a.100.1.1 (A:158-289) Hydroxyisobutyrate dehydrogenase {Thermus thermophilus [TaxId: 274]}
vgaghavkainnallavnlwaagegllalvkqgvsaekalevinassgrsnatenlipqr
vltrafpktfalgllvkdlgiamgvldgekapspllrlarevyemakrelgpdadhveal
rllerwggveir

SCOPe Domain Coordinates for d1wp4a1:

Click to download the PDB-style file with coordinates for d1wp4a1.
(The format of our PDB-style files is described here.)

Timeline for d1wp4a1: