SCOPe 2.06: Domain d1woya2: 1woy A:1-348

Lineage for d1woya2 (1woy A:1-348)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
   contains a conserved all-alpha subdomain at the C-terminal extension

6. Protein automated matches [190581] (9 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [254946] (3 PDB entries)

8. Domain d1woya2: 1woy A:1-348 [121131]
   Other proteins in same PDB: d1woya1
   automated match to d1a8ha2
   complexed with zn; mutant

Details for d1woya2

PDB Entry: 1woy, 2 Å

PDB Description: crystal structure of methionyl trna synthetase y225f mutant from thermus thermophilus

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1woya2:

Sequence; same for both SEQRES and ATOM records:

>d1woya2 c.26.1.1 (A:1-348) automated matches {Thermus thermophilus [TaxId: 274]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtfvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

Timeline for d1woya2:

• d1woya2 first appeared in SCOP 1.73
  
• d1woya2 appears in SCOPe 2.05
  
• d1woya2 appears in SCOPe 2.07
  
• d1woya2 appears in the current release, SCOPe 2.08