Lineage for d1woya2 (1woy A:1-348)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693366Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 693367Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 693368Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (12 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 693440Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)
  7. 693453Species Thermus thermophilus [TaxId:274] [52385] (4 PDB entries)
  8. 693455Domain d1woya2: 1woy A:1-348 [121131]
    Other proteins in same PDB: d1woya1
    automatically matched to d1a8h_2
    complexed with zn; mutant

Details for d1woya2

PDB Entry: 1woy (more details), 2 Å

PDB Description: crystal structure of methionyl trna synthetase y225f mutant from thermus thermophilus
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOP Domain Sequences for d1woya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woya2 c.26.1.1 (A:1-348) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]}
mekvfyvttpiyyvnaephlghayttvvadflarwhrldgyrtffltgtdehgetvyraa
qaagedpkafvdrvsgrfkrawdllgiayddfirtteerhkkvvqlvlkkvyeagdiyyg
eyeglycvscerfytekelveglcpihgrpverrkegnyffrmekyrpwlqeyiqenpdl
irpegyrnevlamlaepigdlsisrpksrvpwgiplpwdenhvtfvwfdallnyvsaldy
pegeayrtfwphawhligkdilkphavfwptmlkaagipmyrhlnvggfllgpdgrkmsk
tlgnvvdpfallekygrdalryyllreipygqdtpvseealrtryead

SCOP Domain Coordinates for d1woya2:

Click to download the PDB-style file with coordinates for d1woya2.
(The format of our PDB-style files is described here.)

Timeline for d1woya2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1woya1