![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily) core: 4 helices; bundle; one loop crosses over one side of the bundle |
![]() | Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (1 family) ![]() |
![]() | Family a.27.1.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47324] (6 proteins) |
![]() | Protein Methionyl-tRNA synthetase (MetRS) [47325] (3 species) this domain follows the Rossmann-fold catalytic domain of class I aaRS |
![]() | Species Thermus thermophilus [TaxId:274] [47326] (4 PDB entries) |
![]() | Domain d1woya1: 1woy A:349-500 [121130] Other proteins in same PDB: d1woya2 automatically matched to d1a8h_1 complexed with zn; mutant |
PDB Entry: 1woy (more details), 2 Å
SCOP Domain Sequences for d1woya1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woya1 a.27.1.1 (A:349-500) Methionyl-tRNA synthetase (MetRS) {Thermus thermophilus [TaxId: 274]} laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg lkeevrleeaerwglaeprpipeeapvlfpkk
Timeline for d1woya1: