Lineage for d1woya1 (1woy A:349-500)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1991849Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
    core: 4 helices; bundle; one loop crosses over one side of the bundle
  4. 1991850Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families) (S)
  5. 1991903Family a.27.1.0: automated matches [227164] (1 protein)
    not a true family
  6. 1991904Protein automated matches [226872] (8 species)
    not a true protein
  7. 1991921Species Thermus thermophilus [TaxId:274] [254947] (3 PDB entries)
  8. 1991923Domain d1woya1: 1woy A:349-500 [121130]
    Other proteins in same PDB: d1woya2
    automated match to d2d5ba1
    complexed with zn; mutant

Details for d1woya1

PDB Entry: 1woy (more details), 2 Å

PDB Description: Crystal structure of methionyl tRNA synthetase Y225F mutant from Thermus thermophilus
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1woya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woya1 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus [TaxId: 274]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

SCOPe Domain Coordinates for d1woya1:

Click to download the PDB-style file with coordinates for d1woya1.
(The format of our PDB-style files is described here.)

Timeline for d1woya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1woya2