SCOPe 2.08: Domain d1woya1: 1woy A:349-500

Lineage for d1woya1 (1woy A:349-500)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.27: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47322] (1 superfamily)
   core: 4 helices; bundle; one loop crosses over one side of the bundle

4. Superfamily a.27.1: Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases [47323] (2 families)

5. Family a.27.1.0: automated matches [227164] (1 protein)
   not a true family

6. Protein automated matches [226872] (13 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:274] [254947] (3 PDB entries)

8. Domain d1woya1: 1woy A:349-500 [121130]
   Other proteins in same PDB: d1woya2
   automated match to d2d5ba1
   complexed with zn; mutant

Details for d1woya1

PDB Entry: 1woy, 2 Å

PDB Description: crystal structure of methionyl trna synthetase y225f mutant from thermus thermophilus

PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1woya1:

Sequence; same for both SEQRES and ATOM records:

>d1woya1 a.27.1.0 (A:349-500) automated matches {Thermus thermophilus [TaxId: 274]}
laddlgnlvqrtramlfrfaegripepvageelaegtglagrlrplvrelkfhvaleeam
ayvkalnryinekkpwelfkkepeearavlyrvveglriasilltpampdkmaelrralg
lkeevrleeaerwglaeprpipeeapvlfpkk

Timeline for d1woya1:

• d1woya1 first appeared in SCOP 1.73
  
• d1woya1 appears in SCOPe 2.07