Lineage for d1wowb1 (1wow B:2-250)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 648983Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 648984Superfamily a.132.1: Heme oxygenase-like [48613] (4 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 648985Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (3 proteins)
  6. 648986Protein Heme oxygenase 2 [140948] (1 species)
  7. 648987Species Synechocystis sp. pcc 6803 [TaxId:1148] [140949] (3 PDB entries)
  8. 648993Domain d1wowb1: 1wow B:2-250 [121127]
    automatically matched to 1WOV A:2-250
    complexed with hem

Details for d1wowb1

PDB Entry: 1wow (more details), 2.2 Å

PDB Description: Crystal structure of heme oxygenase-2 from Synechocystis sp. PCC 6803 complexed with heme in ferrous form
PDB Compounds: (B:) Heme oxygenase 2

SCOP Domain Sequences for d1wowb1:

Sequence, based on SEQRES records: (download)

>d1wowb1 a.132.1.1 (B:2-250) Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearstag
hpitlmvge

Sequence, based on observed residues (ATOM records): (download)

>d1wowb1 a.132.1.1 (B:2-250) Heme oxygenase 2 {Synechocystis sp. pcc 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstepitlmv
ge

SCOP Domain Coordinates for d1wowb1:

Click to download the PDB-style file with coordinates for d1wowb1.
(The format of our PDB-style files is described here.)

Timeline for d1wowb1: