Lineage for d1wowb_ (1wow B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011418Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 protein domains)
    automatically mapped to Pfam PF01126
  6. 2011554Protein automated matches [190372] (2 species)
    not a true protein
  7. 2011558Species Synechocystis sp. PCC 6803 [TaxId:1148] [188085] (3 PDB entries)
  8. 2011563Domain d1wowb_: 1wow B: [121127]
    automated match to d1wova1
    complexed with hem

Details for d1wowb_

PDB Entry: 1wow (more details), 2.2 Å

PDB Description: Crystal structure of heme oxygenase-2 from Synechocystis sp. PCC 6803 complexed with heme in ferrous form
PDB Compounds: (B:) Heme oxygenase 2

SCOPe Domain Sequences for d1wowb_:

Sequence, based on SEQRES records: (download)

>d1wowb_ a.132.1.1 (B:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearstag
hpitlmvge

Sequence, based on observed residues (ATOM records): (download)

>d1wowb_ a.132.1.1 (B:) automated matches {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstepitlmv
ge

SCOPe Domain Coordinates for d1wowb_:

Click to download the PDB-style file with coordinates for d1wowb_.
(The format of our PDB-style files is described here.)

Timeline for d1wowb_: