Lineage for d1wova1 (1wov A:2-250)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011416Fold a.132: Heme oxygenase-like [48612] (1 superfamily)
    multihelical; bundle
  4. 2011417Superfamily a.132.1: Heme oxygenase-like [48613] (5 families) (S)
    duplication: contains two structural repeats of 3-helical motif
  5. 2011418Family a.132.1.1: Eukaryotic type heme oxygenase [48614] (4 protein domains)
    automatically mapped to Pfam PF01126
  6. 2011419Protein Heme oxygenase 2 [140948] (1 species)
  7. 2011420Species Synechocystis sp. PCC 6803 [TaxId:1148] [140949] (1 PDB entry)
    Uniprot P74133 2-250
  8. 2011421Domain d1wova1: 1wov A:2-250 [121124]
    Other proteins in same PDB: d1wovb_
    complexed with hem

Details for d1wova1

PDB Entry: 1wov (more details), 1.75 Å

PDB Description: Crystal strucure of heme oxygenase-2 from Synechocystis sp. PCC 6803 in complex with heme
PDB Compounds: (A:) Heme oxygenase 2

SCOPe Domain Sequences for d1wova1:

Sequence, based on SEQRES records: (download)

>d1wova1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgstearstag
hpitlmvge

Sequence, based on observed residues (ATOM records): (download)

>d1wova1 a.132.1.1 (A:2-250) Heme oxygenase 2 {Synechocystis sp. PCC 6803 [TaxId: 1148]}
tnlaqklrygtqqshtlaentaymkcflkgiverepfrqllanlyylysaleaalrqhrd
neiisaiyfpelnrtdklaedltyyygpnwqqiiqptpcakiyvdrlktiaasepellia
hcytrylgdlsggqslkniirsalqlpegegtamyefdslptpgdrrqfkeiyrdvlnsl
pldeatinriveeanyafslnrevmhdledlikaaigehtfdlltrqdrpgsteghpitl
mvge

SCOPe Domain Coordinates for d1wova1:

Click to download the PDB-style file with coordinates for d1wova1.
(The format of our PDB-style files is described here.)

Timeline for d1wova1: