SCOP 1.75: Domain d1wokd2: 1wok D:799-1011

Lineage for d1wokd2 (1wok D:799-1011)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (7 families)

5. Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (1 protein)

6. Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [103339] (5 PDB entries)
   Uniprot P09874 661-1010

8. Domain d1wokd2: 1wok D:799-1011 [121123]
   Other proteins in same PDB: d1woka1, d1wokb1, d1wokc1, d1wokd1
   automatically matched to d1uk0a2
   complexed with cnq

Details for d1wokd2

PDB Entry: 1wok, 3 Å

PDB Description: crystal structure of catalytic domain of human poly(adp-ribose) polymerase complexed with a quinoxaline-type inhibitor

PDB Compounds: (D:) Poly [ADP-ribose] polymerase-1

SCOP Domain Sequences for d1wokd2:

Sequence; same for both SEQRES and ATOM records:

>d1wokd2 d.166.1.2 (D:799-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhnrr
llwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpigl
illgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgissg
vndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d1wokd2:

• d1wokd2 first appeared in SCOP 1.73
  
• d1wokd2 appears in SCOPe 2.01
  
• d1wokd2 appears in the current release, SCOPe 2.08