Lineage for d1wokd1 (1wok D:662-798)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 641547Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 641548Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
  5. 641549Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 641550Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 641559Species Human (Homo sapiens) [TaxId:9606] [101198] (3 PDB entries)
  8. 641563Domain d1wokd1: 1wok D:662-798 [121122]
    Other proteins in same PDB: d1woka2, d1wokb2, d1wokc2, d1wokd2
    automatically matched to d1uk0a1
    complexed with cnq

Details for d1wokd1

PDB Entry: 1wok (more details), 3 Å

PDB Description: crystal structure of catalytic domain of human poly(adp-ribose) polymerase complexed with a quinoxaline-type inhibitor
PDB Compounds: (D:) Poly [ADP-ribose] polymerase-1

SCOP Domain Sequences for d1wokd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wokd1 a.41.1.1 (D:662-798) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyeklk

SCOP Domain Coordinates for d1wokd1:

Click to download the PDB-style file with coordinates for d1wokd1.
(The format of our PDB-style files is described here.)

Timeline for d1wokd1: