SCOPe 2.07: Domain d1wokc2: 1wok C:797-1011

Lineage for d1wokc2 (1wok C:797-1011)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries)

8. Domain d1wokc2: 1wok C:797-1011 [121121]
   Other proteins in same PDB: d1woka1, d1wokb1, d1wokc1, d1wokd1
   automated match to d4hhyd2
   complexed with cnq

Details for d1wokc2

PDB Entry: 1wok, 3 Å

PDB Description: crystal structure of catalytic domain of human poly(adp-ribose) polymerase complexed with a quinoxaline-type inhibitor

PDB Compounds: (C:) Poly [ADP-ribose] polymerase-1

SCOPe Domain Sequences for d1wokc2:

Sequence; same for both SEQRES and ATOM records:

>d1wokc2 d.166.1.0 (C:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

Timeline for d1wokc2:

• d1wokc2 first appeared in SCOP 1.73
  
• d1wokc2 appears in SCOPe 2.06
  
• d1wokc2 appears in the current release, SCOPe 2.08