Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.166: ADP-ribosylation [56398] (1 superfamily) unusual fold |
Superfamily d.166.1: ADP-ribosylation [56399] (8 families) |
Family d.166.1.0: automated matches [191650] (1 protein) not a true family |
Protein automated matches [191197] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225406] (55 PDB entries) |
Domain d1wokc2: 1wok C:797-1011 [121121] Other proteins in same PDB: d1woka1, d1wokb1, d1wokc1, d1wokd1 automated match to d4hhyd2 complexed with cnq |
PDB Entry: 1wok (more details), 3 Å
SCOPe Domain Sequences for d1wokc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wokc2 d.166.1.0 (C:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]} lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis sgvndtsllyneyivydiaqvnlkyllklkfnfkt
Timeline for d1wokc2: