Lineage for d1wokc1 (1wok C:662-796)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2325363Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 2325364Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 2325389Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 2325390Protein automated matches [226964] (2 species)
    not a true protein
  7. 2325394Species Human (Homo sapiens) [TaxId:9606] [225405] (61 PDB entries)
  8. 2325516Domain d1wokc1: 1wok C:662-796 [121120]
    Other proteins in same PDB: d1woka2, d1wokb2, d1wokc2, d1wokd2
    automated match to d4hhyd1
    complexed with cnq

Details for d1wokc1

PDB Entry: 1wok (more details), 3 Å

PDB Description: crystal structure of catalytic domain of human poly(adp-ribose) polymerase complexed with a quinoxaline-type inhibitor
PDB Compounds: (C:) Poly [ADP-ribose] polymerase-1

SCOPe Domain Sequences for d1wokc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wokc1 a.41.1.0 (C:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d1wokc1:

Click to download the PDB-style file with coordinates for d1wokc1.
(The format of our PDB-style files is described here.)

Timeline for d1wokc1: