Lineage for d1wokb1 (1wok B:662-798)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769460Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 769461Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (1 family) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
  5. 769462Family a.41.1.1: Domain of poly(ADP-ribose) polymerase [47588] (1 protein)
  6. 769463Protein Domain of poly(ADP-ribose) polymerase [47589] (3 species)
  7. 769472Species Human (Homo sapiens) [TaxId:9606] [101198] (5 PDB entries)
    Uniprot P09874 661-1010
  8. 769476Domain d1wokb1: 1wok B:662-798 [121118]
    Other proteins in same PDB: d1woka2, d1wokb2, d1wokc2, d1wokd2
    automatically matched to d1uk0a1
    complexed with cnq

Details for d1wokb1

PDB Entry: 1wok (more details), 3 Å

PDB Description: crystal structure of catalytic domain of human poly(adp-ribose) polymerase complexed with a quinoxaline-type inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase-1

SCOP Domain Sequences for d1wokb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wokb1 a.41.1.1 (B:662-798) Domain of poly(ADP-ribose) polymerase {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyeklk

SCOP Domain Coordinates for d1wokb1:

Click to download the PDB-style file with coordinates for d1wokb1.
(The format of our PDB-style files is described here.)

Timeline for d1wokb1: