Lineage for d1wokb1 (1wok B:662-796)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996130Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily)
    core: 4 helices: bundle; unusual topology
  4. 1996131Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) (S)
    duplication: consists of 2 helix-loop-helix structural repeats
    automatically mapped to Pfam PF02877
  5. 1996156Family a.41.1.0: automated matches [227223] (1 protein)
    not a true family
  6. 1996157Protein automated matches [226964] (1 species)
    not a true protein
  7. 1996158Species Human (Homo sapiens) [TaxId:9606] [225405] (34 PDB entries)
  8. 1996215Domain d1wokb1: 1wok B:662-796 [121118]
    Other proteins in same PDB: d1woka2, d1wokb2, d1wokc2, d1wokd2
    automated match to d4hhyd1
    complexed with cnq

Details for d1wokb1

PDB Entry: 1wok (more details), 3 Å

PDB Description: Crystal structure of catalytic domain of human poly(ADP-ribose) polymerase complexed with a quinoxaline-type inhibitor
PDB Compounds: (B:) Poly [ADP-ribose] polymerase-1

SCOPe Domain Sequences for d1wokb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wokb1 a.41.1.0 (B:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs
qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg
sddsskdpidvnyek

SCOPe Domain Coordinates for d1wokb1:

Click to download the PDB-style file with coordinates for d1wokb1.
(The format of our PDB-style files is described here.)

Timeline for d1wokb1: