Lineage for d1woka2 (1wok A:797-1011)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234201Species Human (Homo sapiens) [TaxId:9606] [225406] (38 PDB entries)
  8. 2234266Domain d1woka2: 1wok A:797-1011 [121117]
    Other proteins in same PDB: d1woka1, d1wokb1, d1wokc1, d1wokd1
    automated match to d4hhyd2
    complexed with cnq

Details for d1woka2

PDB Entry: 1wok (more details), 3 Å

PDB Description: crystal structure of catalytic domain of human poly(adp-ribose) polymerase complexed with a quinoxaline-type inhibitor
PDB Compounds: (A:) Poly [ADP-ribose] polymerase-1

SCOPe Domain Sequences for d1woka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1woka2 d.166.1.0 (A:797-1011) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkt

SCOPe Domain Coordinates for d1woka2:

Click to download the PDB-style file with coordinates for d1woka2.
(The format of our PDB-style files is described here.)

Timeline for d1woka2: