![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
![]() | Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
![]() | Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
![]() | Protein automated matches [226964] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries) |
![]() | Domain d1woka1: 1wok A:662-796 [121116] Other proteins in same PDB: d1woka2, d1wokb2, d1wokc2, d1wokd2 automated match to d4hhyd1 complexed with cnq |
PDB Entry: 1wok (more details), 3 Å
SCOPe Domain Sequences for d1woka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1woka1 a.41.1.0 (A:662-796) automated matches {Human (Homo sapiens) [TaxId: 9606]} ksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqavs qgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrgg sddsskdpidvnyek
Timeline for d1woka1: