SCOPe 2.07: Domain d1wo8d_: 1wo8 D:

Lineage for d1wo8d_ (1wo8 D:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families)
   contains a common phosphate-binding site

5. Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)

6. Protein Methylglyoxal synthase, MgsA [52340] (3 species)

7. Species Thermus thermophilus [TaxId:274] [142080] (1 PDB entry)
   Uniprot Q5SHD6 1-126

8. Domain d1wo8d_: 1wo8 D: [121113]
   automated match to d1wo8a1
   complexed with so4

Details for d1wo8d_

PDB Entry: 1wo8, 1.7 Å

PDB Description: Crystal structure of methylglyoxal synthase from Thermus thermophilus HB8

PDB Compounds: (D:) methylglyoxal synthase

SCOPe Domain Sequences for d1wo8d_:

Sequence; same for both SEQRES and ATOM records:

>d1wo8d_ c.24.1.2 (D:) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]}
mkalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplgg
dlqigarvaegkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawi
rkg

Timeline for d1wo8d_:

• d1wo8d_ first appeared in SCOP 1.73, called d1wo8d1
  
• d1wo8d_ appears in SCOPe 2.06
  
• d1wo8d_ appears in the current release, SCOPe 2.08