![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) ![]() contains a common phosphate-binding site |
![]() | Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins) |
![]() | Protein Methylglyoxal synthase, MgsA [52340] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142080] (1 PDB entry) Uniprot Q5SHD6 1-126 |
![]() | Domain d1wo8d_: 1wo8 D: [121113] automated match to d1wo8a1 complexed with so4 |
PDB Entry: 1wo8 (more details), 1.7 Å
SCOPe Domain Sequences for d1wo8d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wo8d_ c.24.1.2 (D:) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} mkalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplgg dlqigarvaegkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawi rkg
Timeline for d1wo8d_: