SCOP 1.73: Domain d1wo8d1: 1wo8 D:1-123

Lineage for d1wo8d1 (1wo8 D:1-123)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
   3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families)
   contains a common phosphate-binding site

5. Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (1 protein)

6. Protein Methylglyoxal synthase, MgsA [52340] (3 species)

7. Species Thermus thermophilus [TaxId:274] [142080] (1 PDB entry)

8. Domain d1wo8d1: 1wo8 D:1-123 [121113]
   automatically matched to 1WO8 A:1-126
   complexed with so4

Details for d1wo8d1

PDB Entry: 1wo8, 1.7 Å

PDB Description: Crystal structure of methylglyoxal synthase from Thermus thermophilus HB8

PDB Compounds: (D:) methylglyoxal synthase

SCOP Domain Sequences for d1wo8d1:

Sequence; same for both SEQRES and ATOM records:

>d1wo8d1 c.24.1.2 (D:1-123) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]}
mkalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplgg
dlqigarvaegkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawi
rkg

Timeline for d1wo8d1:

• d1wo8d1 is new in SCOP 1.73
  
• d1wo8d1 appears in SCOP 1.75
  
• d1wo8d1 appears in the current release, SCOPe 2.08, called d1wo8d_