![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
![]() | Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) ![]() contains a common phosphate-binding site |
![]() | Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (1 protein) |
![]() | Protein Methylglyoxal synthase, MgsA [52340] (3 species) |
![]() | Species Thermus thermophilus [TaxId:274] [142080] (1 PDB entry) |
![]() | Domain d1wo8d1: 1wo8 D:1-123 [121113] automatically matched to 1WO8 A:1-126 complexed with so4 |
PDB Entry: 1wo8 (more details), 1.7 Å
SCOP Domain Sequences for d1wo8d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wo8d1 c.24.1.2 (D:1-123) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]} mkalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplgg dlqigarvaegkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawi rkg
Timeline for d1wo8d1: