Lineage for d1wo8d_ (1wo8 D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2859565Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2859566Superfamily c.24.1: Methylglyoxal synthase-like [52335] (4 families) (S)
    contains a common phosphate-binding site
  5. 2859610Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2859611Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 2859643Species Thermus thermophilus [TaxId:274] [142080] (1 PDB entry)
    Uniprot Q5SHD6 1-126
  8. 2859647Domain d1wo8d_: 1wo8 D: [121113]
    automated match to d1wo8a1
    complexed with so4

Details for d1wo8d_

PDB Entry: 1wo8 (more details), 1.7 Å

PDB Description: Crystal structure of methylglyoxal synthase from Thermus thermophilus HB8
PDB Compounds: (D:) methylglyoxal synthase

SCOPe Domain Sequences for d1wo8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wo8d_ c.24.1.2 (D:) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]}
mkalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplgg
dlqigarvaegkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawi
rkg

SCOPe Domain Coordinates for d1wo8d_:

Click to download the PDB-style file with coordinates for d1wo8d_.
(The format of our PDB-style files is described here.)

Timeline for d1wo8d_: