Lineage for d1wo8c1 (1wo8 C:1-123)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 693128Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 693129Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 693173Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (1 protein)
  6. 693174Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 693206Species Thermus thermophilus [TaxId:274] [142080] (1 PDB entry)
  8. 693209Domain d1wo8c1: 1wo8 C:1-123 [121112]
    automatically matched to 1WO8 A:1-126
    complexed with so4

Details for d1wo8c1

PDB Entry: 1wo8 (more details), 1.7 Å

PDB Description: Crystal structure of methylglyoxal synthase from Thermus thermophilus HB8
PDB Compounds: (C:) methylglyoxal synthase

SCOP Domain Sequences for d1wo8c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wo8c1 c.24.1.2 (C:1-123) Methylglyoxal synthase, MgsA {Thermus thermophilus [TaxId: 274]}
mkalaliahdakkdemvafclrhkdvlarypllatgttgariqeatglavervlsgplgg
dlqigarvaegkvlavvflqdpltakphepdvqalmrvcnvhgvplatnlvaaealiawi
rkg

SCOP Domain Coordinates for d1wo8c1:

Click to download the PDB-style file with coordinates for d1wo8c1.
(The format of our PDB-style files is described here.)

Timeline for d1wo8c1: