Lineage for d1wo2a2 (1wo2 A:1-403)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093019Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2093059Protein Animal alpha-amylase [51458] (3 species)
    contains Ca2+-binding subdomain, residues 100-170
  7. 2093114Species Pig (Sus scrofa) [TaxId:9823] [51459] (13 PDB entries)
  8. 2093123Domain d1wo2a2: 1wo2 A:1-403 [121109]
    Other proteins in same PDB: d1wo2a1
    automated match to d1hx0a2
    complexed with ca, cl, edo

Details for d1wo2a2

PDB Entry: 1wo2 (more details), 2.01 Å

PDB Description: crystal structure of the pig pancreatic alpha-amylase complexed with malto-oligosaacharides under the effect of the chloride ion
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1wo2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wo2a2 c.1.8.1 (A:1-403) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
eyapqtqsgrtsivhlfewrwvdialecerylgpkgfggvqvsppnenivvtnpsrpwwe
ryqpvsyklctrsgnenefrdmvtrcnnvgvriyvdavinhmcgsgaaagtgttcgsycn
pgnrefpavpysawdfndgkcktasggiesyndpyqvrdcqlvglldlalekdyvrsmia
dylnklidigvagfridaskhmwpgdikavldklhnlntnwfpagsrpfifqevidlgge
aiksseyfgngrvtefkygaklgtvvrkwsgekmsylknwgegwgfmpsdralvfvdnhd
nqrghgaggssiltfwdarlykiavgfmlahpygftrvmssyrwarnfvngedvndwigp
pnnngvikevtinadttcgndwvcehrwreirnmvwfrnvvdg

SCOPe Domain Coordinates for d1wo2a2:

Click to download the PDB-style file with coordinates for d1wo2a2.
(The format of our PDB-style files is described here.)

Timeline for d1wo2a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wo2a1