SCOPe 2.07: Domain d1wo2a1: 1wo2 A:404-496

Lineage for d1wo2a1 (1wo2 A:404-496)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)

8. Domain d1wo2a1: 1wo2 A:404-496 [121108]
   Other proteins in same PDB: d1wo2a2
   automated match to d1hx0a1
   complexed with ca, cl, edo

Details for d1wo2a1

PDB Entry: 1wo2, 2.01 Å

PDB Description: crystal structure of the pig pancreatic alpha-amylase complexed with malto-oligosaacharides under the effect of the chloride ion

PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1wo2a1:

Sequence; same for both SEQRES and ATOM records:

>d1wo2a1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1wo2a1:

• d1wo2a1 first appeared in SCOP 1.73
  
• d1wo2a1 appears in SCOPe 2.06
  
• d1wo2a1 appears in the current release, SCOPe 2.08