Lineage for d1wo2a1 (1wo2 A:404-496)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2419830Protein Animal alpha-amylase [51024] (3 species)
  7. 2419887Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)
  8. 2419896Domain d1wo2a1: 1wo2 A:404-496 [121108]
    Other proteins in same PDB: d1wo2a2
    automated match to d1hx0a1
    complexed with ca, cl, edo

Details for d1wo2a1

PDB Entry: 1wo2 (more details), 2.01 Å

PDB Description: crystal structure of the pig pancreatic alpha-amylase complexed with malto-oligosaacharides under the effect of the chloride ion
PDB Compounds: (A:) alpha-amylase, pancreatic

SCOPe Domain Sequences for d1wo2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wo2a1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1wo2a1:

Click to download the PDB-style file with coordinates for d1wo2a1.
(The format of our PDB-style files is described here.)

Timeline for d1wo2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1wo2a2