Lineage for d1wnub1 (1wnu B:1-152)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 726471Fold d.67: RRF/tRNA synthetase additional domain-like [55185] (4 superfamilies)
    core: alpha-beta(2)-alpha-beta(2); 2 layers: alpha/beta
  4. 726472Superfamily d.67.1: ThrRS/AlaRS common domain [55186] (2 families) (S)
    putative editing domain found in the N-terminal part of ThrRS, the C-terminal of AlaRS, and as a stand-alone protein; probable circular permutation of LuxS (d.185.1.2)
  5. 726486Family d.67.1.2: Hypothetical protein PH0574 [103051] (1 protein)
  6. 726487Protein Hypothetical protein PH0574 [103052] (1 species)
    stand-alone protein related to the AlaRS domain
  7. 726488Species Archaeon Pyrococcus horikoshii [TaxId:53953] [103053] (4 PDB entries)
  8. 726498Domain d1wnub1: 1wnu B:1-152 [121107]
    automatically matched to d1v7oa_
    complexed with ser, zn

Details for d1wnub1

PDB Entry: 1wnu (more details), 2.8 Å

PDB Description: Structure of Archaeal Trans-Editing Protein AlaX in complex with L-serine
PDB Compounds: (B:) Alanyl-tRNA synthetase

SCOP Domain Sequences for d1wnub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnub1 d.67.1.2 (B:1-152) Hypothetical protein PH0574 {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mysievrthsalhvvkgavvkvlgseakwtystyvkgnkgvlivkfdrkpsdeeireier
lanekvkenapikiyelpreeaekmfgedmydlfpvpedvrilkvvviedwnvnacnkeh
tkttgeigpikirkvrfrkskglleihfelle

SCOP Domain Coordinates for d1wnub1:

Click to download the PDB-style file with coordinates for d1wnub1.
(The format of our PDB-style files is described here.)

Timeline for d1wnub1: