Lineage for d1wntb1 (1wnt B:1-244)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 686492Protein Carbonyl reductase [51765] (2 species)
  7. 686493Species Human (Homo sapiens) [TaxId:9606] [102144] (2 PDB entries)
    dicarbonyl/L-xylulose reductase
  8. 686497Domain d1wntb1: 1wnt B:1-244 [121103]
    automatically matched to d1pr9a_
    complexed with nap

Details for d1wntb1

PDB Entry: 1wnt (more details), 2.3 Å

PDB Description: structure of the tetrameric form of human l-xylulose reductase
PDB Compounds: (B:) L-xylulose reductase

SCOP Domain Sequences for d1wntb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wntb1 c.2.1.2 (B:1-244) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]}
melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd
lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar
gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt
vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg
fwac

SCOP Domain Coordinates for d1wntb1:

Click to download the PDB-style file with coordinates for d1wntb1.
(The format of our PDB-style files is described here.)

Timeline for d1wntb1: