![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) ![]() |
![]() | Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
![]() | Protein Carbonyl reductase [51765] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [102144] (2 PDB entries) dicarbonyl/L-xylulose reductase |
![]() | Domain d1wnta1: 1wnt A:1-244 [121102] automatically matched to d1pr9a_ complexed with nap |
PDB Entry: 1wnt (more details), 2.3 Å
SCOP Domain Sequences for d1wnta1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wnta1 c.2.1.2 (A:1-244) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} melflagrrvlvtgagkgigrgtvqalhatgarvvavsrtqadldslvrecpgiepvcvd lgdweateralgsvgpvdllvnnaavallqpflevtkeafdrsfevnlraviqvsqivar gliargvpgaivnvssqcsqravtnhsvycstkgaldmltkvmalelgphkirvnavnpt vvmtsmgqatwsdphkaktmlnriplgkfaevehvvnailfllsdrsgmttgstlpvegg fwac
Timeline for d1wnta1: