![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) ![]() |
![]() | Family c.1.8.5: Type II chitinase [51534] (15 proteins) glycosylase family 18 |
![]() | Protein Chitinase 1 [51548] (2 species) |
![]() | Species Aspergillus fumigatus [TaxId:5085] [117368] (14 PDB entries) Uniprot Q873X9 |
![]() | Domain d1wnob1: 1wno B:1-260,B:323-394 [121100] Other proteins in same PDB: d1wnoa2, d1wnob2 automatically matched to 1WNO A:1-260,A:323-394 complexed with mg, nag, ndg, so4 |
PDB Entry: 1wno (more details), 2.1 Å
SCOPe Domain Sequences for d1wnob1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wnob1 c.1.8.5 (B:1-260,B:323-394) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]} assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak tavkllqdlgfdgldidweypendqqandfvlllrevrtaldsysaanaggqhflltvas pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt vvnalggtgvfeqsqneldypvsqydnlrngmq
Timeline for d1wnob1: