SCOP 1.73: Domain d1wnob1: 1wno B:1-260,B:323-394

Lineage for d1wnob1 (1wno B:1-260,B:323-394)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (14 families)

5. Family c.1.8.5: Type II chitinase [51534] (14 proteins)
   glycosylase family 18

6. Protein Chitinase 1 [51548] (2 species)

7. Species Aspergillus fumigatus [TaxId:5085] [117368] (9 PDB entries)

8. Domain d1wnob1: 1wno B:1-260,B:323-394 [121100]
   Other proteins in same PDB: d1wnoa2, d1wnob2
   automatically matched to 1WNO A:1-260,A:323-394
   complexed with mg, nag, ndg, so4

Details for d1wnob1

PDB Entry: 1wno, 2.1 Å

PDB Description: crystal structure of a native chitinase from aspergillus fumigatus yj- 407

PDB Compounds: (B:) chitinase

SCOP Domain Sequences for d1wnob1:

Sequence; same for both SEQRES and ATOM records:

>d1wnob1 c.1.8.5 (B:1-260,B:323-394) Chitinase 1 {Aspergillus fumigatus [TaxId: 5085]}
assgyrsvvyfvnwaiygrnhnpqdlpverlthvlyafanvrpetgevymtdswadiekh
ypgdswsdtgnnvygcikqlyllkkqnrnlkvllsiggwtyspnfapaastdagrknfak
tavkllqdlgfdgldidweypendqqandfvlllrevrtaldsysaanaggqhflltvas
pagpdkikvlhlkdmdqqldfwnlmaydyagsfsslsghqanvyndtsnplstpfntqta
ldlyraggvpankivlgmplXdnpqvanlksgyikslglggamwwdsssdktgsdslitt
vvnalggtgvfeqsqneldypvsqydnlrngmq

Timeline for d1wnob1:

• d1wnob1 is new in SCOP 1.73
  
• d1wnob1 appears in SCOP 1.75
  
• d1wnob1 appears in the current release, SCOPe 2.08