SCOP 1.75: Domain d1wnla2: 1wnl A:1-188

Lineage for d1wnla2 (1wnl A:1-188)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (4 families)

5. Family d.104.1.2: Biotin holoenzyme synthetase [55707] (2 proteins)

6. Protein Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain [143640] (1 species)

7. Species Archaeon Pyrococcus horikoshii [TaxId:53953] [143641] (14 PDB entries)
   Uniprot O57883 1-188

8. Domain d1wnla2: 1wnl A:1-188 [121095]
   Other proteins in same PDB: d1wnla1, d1wnlb1
   complexed with adp, gol

Details for d1wnla2

PDB Entry: 1wnl, 1.6 Å

PDB Description: Crystal Structure Of Biotin-(Acetyl-CoA-Carboxylase) ligase From Pyrococcus Horikoshii Ot3 in complex with ADP

PDB Compounds: (A:) biotin--[acetyl-CoA-carboxylase] ligase

SCOP Domain Sequences for d1wnla2:

Sequence; same for both SEQRES and ATOM records:

>d1wnla2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]}
mlglktsiigrrviyfqeitstnefaktsyleegtvivadkqtmghgrlnrkwespeggl
wlsivlspkvpqkdlpkivflgavgvvetlkefsidgrikwpndvlvnykkiagvlvegk
gdkivlgiglnvnnkvpngatsmklelgsevpllsvfrslitnldrlylnflknpmdiln
lvrdnmil

Timeline for d1wnla2:

• d1wnla2 first appeared in SCOP 1.73
  
• d1wnla2 appears in SCOPe 2.01
  
• d1wnla2 appears in the current release, SCOPe 2.08