Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.0: automated matches [191315] (1 protein) not a true family |
Protein automated matches [190076] (5 species) not a true protein |
Species Pyrococcus horikoshii [TaxId:53953] [186827] (1 PDB entry) |
Domain d1wngb_: 1wng B: [121093] automated match to d1vhva_ complexed with sah, so4 |
PDB Entry: 1wng (more details), 2.1 Å
SCOPe Domain Sequences for d1wngb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wngb_ c.90.1.0 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]} mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg klhiveaeylveiagapreilrvnv
Timeline for d1wngb_: