Lineage for d1wnga_ (1wng A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911790Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2911791Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2912033Family c.90.1.0: automated matches [191315] (1 protein)
    not a true family
  6. 2912034Protein automated matches [190076] (5 species)
    not a true protein
  7. 2912044Species Pyrococcus horikoshii [TaxId:53953] [186827] (1 PDB entry)
  8. 2912045Domain d1wnga_: 1wng A: [121092]
    automated match to d1vhva_
    complexed with sah, so4

Details for d1wnga_

PDB Entry: 1wng (more details), 2.1 Å

PDB Description: Structural study of project ID PH0725 from Pyrococcus horikoshii OT3
PDB Compounds: (A:) Probable diphthine synthase

SCOPe Domain Sequences for d1wnga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnga_ c.90.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

SCOPe Domain Coordinates for d1wnga_:

Click to download the PDB-style file with coordinates for d1wnga_.
(The format of our PDB-style files is described here.)

Timeline for d1wnga_: