SCOPe 2.08: Domain d1wnga_: 1wng A:

Lineage for d1wnga_ (1wng A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
   consists of two non-similar domains
   Domain 1 has parallel sheet of 5 strands, order 32415
   Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest

4. Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families)

5. Family c.90.1.0: automated matches [191315] (1 protein)
   not a true family

6. Protein automated matches [190076] (5 species)
   not a true protein

7. Species Pyrococcus horikoshii [TaxId:53953] [186827] (1 PDB entry)

8. Domain d1wnga_: 1wng A: [121092]
   automated match to d1vhva_
   complexed with sah, so4

Details for d1wnga_

PDB Entry: 1wng, 2.1 Å

PDB Description: Structural study of project ID PH0725 from Pyrococcus horikoshii OT3

PDB Compounds: (A:) Probable diphthine synthase

SCOPe Domain Sequences for d1wnga_:

Sequence; same for both SEQRES and ATOM records:

>d1wnga_ c.90.1.0 (A:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mvlyfiglglyderditvkgleiakkcdyvfaefytslmagttlgriqkligkeirvlsr
edvelnfenivlplakendvafltpgdplvatthaelrirakragvesyvihapsiysav
gitglhiykfgksatvaypegnwfptsyydvikenaerglhtllfldikaekrmymtane
amelllkvedmkkggvftddtlvvvlaragslnptiragyvkdliredfgdpphilivpg
klhiveaeylveiagapreilrvnv

Timeline for d1wnga_:

• d1wnga_ first appeared in SCOP 1.73, called d1wnga1
  
• d1wnga_ appears in SCOPe 2.07