![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.319: TTHA1528-like [143591] (1 superfamily) beta-alpha-beta(3)-alpha-beta-alpha(2)-beta; 3 layers: a/b/a; mixed beta-sheet, order: 143256, parallel strands' pairs are 1-4 and 2-5 |
![]() | Superfamily d.319.1: TTHA1528-like [143592] (1 family) ![]() automatically mapped to Pfam PF11432 |
![]() | Family d.319.1.1: TTHA1528-like [143593] (2 proteins) |
![]() | Protein automated matches [190811] (2 species) not a true protein |
![]() | Species Thermus thermophilus HB8 [TaxId:300852] [188083] (1 PDB entry) |
![]() | Domain d1wnaa_: 1wna A: [121091] automated match to d1wn9a1 |
PDB Entry: 1wna (more details), 1.58 Å
SCOPe Domain Sequences for d1wnaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wnaa_ d.319.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp tdpgiyl
Timeline for d1wnaa_: