Lineage for d1wnaa_ (1wna A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010878Fold d.319: TTHA1528-like [143591] (1 superfamily)
    beta-alpha-beta(3)-alpha-beta-alpha(2)-beta; 3 layers: a/b/a; mixed beta-sheet, order: 143256, parallel strands' pairs are 1-4 and 2-5
  4. 3010879Superfamily d.319.1: TTHA1528-like [143592] (1 family) (S)
    automatically mapped to Pfam PF11432
  5. 3010880Family d.319.1.1: TTHA1528-like [143593] (2 proteins)
  6. 3010884Protein automated matches [190811] (2 species)
    not a true protein
  7. 3010885Species Thermus thermophilus HB8 [TaxId:300852] [188083] (1 PDB entry)
  8. 3010886Domain d1wnaa_: 1wna A: [121091]
    automated match to d1wn9a1

Details for d1wnaa_

PDB Entry: 1wna (more details), 1.58 Å

PDB Description: Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8
PDB Compounds: (A:) the hypothetical protein (TT1805)

SCOPe Domain Sequences for d1wnaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wnaa_ d.319.1.1 (A:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
tdpgiyl

SCOPe Domain Coordinates for d1wnaa_:

Click to download the PDB-style file with coordinates for d1wnaa_.
(The format of our PDB-style files is described here.)

Timeline for d1wnaa_: