Lineage for d1wn9a1 (1wn9 A:1-127)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 741787Fold d.319: TTHA1528-like [143591] (1 superfamily)
    beta-alpha-beta(3)-alpha-beta-alpha(2)-beta; 3 layers: a/b/a; mixed beta-sheet, order: 143256, parallel strands' pairs are 1-4 and 2-5
  4. 741788Superfamily d.319.1: TTHA1528-like [143592] (1 family) (S)
  5. 741789Family d.319.1.1: TTHA1528-like [143593] (1 protein)
  6. 741790Protein Hypothetical protein TTHA1528 (TT1805) [143594] (1 species)
  7. 741791Species Thermus thermophilus [TaxId:274] [143595] (2 PDB entries)
  8. 741793Domain d1wn9a1: 1wn9 A:1-127 [121090]
    complexed with acy

Details for d1wn9a1

PDB Entry: 1wn9 (more details), 1.58 Å

PDB Description: Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8
PDB Compounds: (A:) the hypothetical protein (TT1805)

SCOP Domain Sequences for d1wn9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wn9a1 d.319.1.1 (A:1-127) Hypothetical protein TTHA1528 (TT1805) {Thermus thermophilus [TaxId: 274]}
mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
tdpgiyl

SCOP Domain Coordinates for d1wn9a1:

Click to download the PDB-style file with coordinates for d1wn9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wn9a1: