Lineage for d1wn9a1 (1wn9 A:1-127)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3010878Fold d.319: TTHA1528-like [143591] (1 superfamily)
    beta-alpha-beta(3)-alpha-beta-alpha(2)-beta; 3 layers: a/b/a; mixed beta-sheet, order: 143256, parallel strands' pairs are 1-4 and 2-5
  4. 3010879Superfamily d.319.1: TTHA1528-like [143592] (1 family) (S)
    automatically mapped to Pfam PF11432
  5. 3010880Family d.319.1.1: TTHA1528-like [143593] (2 proteins)
  6. 3010881Protein Hypothetical protein TTHA1528 (TT1805) [143594] (1 species)
  7. 3010882Species Thermus thermophilus [TaxId:274] [143595] (1 PDB entry)
    Uniprot Q5SI52 1-127
  8. 3010883Domain d1wn9a1: 1wn9 A:1-127 [121090]
    complexed with acy

Details for d1wn9a1

PDB Entry: 1wn9 (more details), 1.58 Å

PDB Description: Crystal structure of the hypothetical protein TT1805 from Thermus thermophillus HB8
PDB Compounds: (A:) the hypothetical protein (TT1805)

SCOPe Domain Sequences for d1wn9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wn9a1 d.319.1.1 (A:1-127) Hypothetical protein TTHA1528 (TT1805) {Thermus thermophilus [TaxId: 274]}
mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp
dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp
tdpgiyl

SCOPe Domain Coordinates for d1wn9a1:

Click to download the PDB-style file with coordinates for d1wn9a1.
(The format of our PDB-style files is described here.)

Timeline for d1wn9a1: