![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.319: TTHA1528-like [143591] (1 superfamily) beta-alpha-beta(3)-alpha-beta-alpha(2)-beta; 3 layers: a/b/a; mixed beta-sheet, order: 143256, parallel strands' pairs are 1-4 and 2-5 |
![]() | Superfamily d.319.1: TTHA1528-like [143592] (1 family) ![]() automatically mapped to Pfam PF11432 |
![]() | Family d.319.1.1: TTHA1528-like [143593] (2 proteins) |
![]() | Protein Hypothetical protein TTHA1528 (TT1805) [143594] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [143595] (1 PDB entry) Uniprot Q5SI52 1-127 |
![]() | Domain d1wn9a1: 1wn9 A:1-127 [121090] complexed with acy |
PDB Entry: 1wn9 (more details), 1.58 Å
SCOPe Domain Sequences for d1wn9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wn9a1 d.319.1.1 (A:1-127) Hypothetical protein TTHA1528 (TT1805) {Thermus thermophilus [TaxId: 274]} mvrvgmraaprvslealkaalgglklseakvylitdwqdkrdqaryalllhtgkkdllvp dafgpafpggeealselvglllaqgarrfyeavvspgemtalldlppeellkrvmaianp tdpgiyl
Timeline for d1wn9a1: