| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) ![]() consists of one domain of this fold |
| Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins) contains Pfam PF00929 |
| Protein Exonuclease domain of family B DNA polymerases [53125] (8 species) elaborated with additional structures and the N-terminal subdomain |
| Species Pyrococcus kodakaraensis [TaxId:311400] [53131] (2 PDB entries) Uniprot P56689 1-758 # 93% sequence identity; Thermococcus kodakarensis KOD1 TaxID: 69014 additional N-terminal subdomain contains rudimental OB-fold but complete ferredoxin-like fold |
| Domain d1wn7a1: 1wn7 A:1-347 [121088] Other proteins in same PDB: d1wn7a2 complexed with gol, ni; mutant has additional subdomain(s) that are not in the common domain |
PDB Entry: 1wn7 (more details), 2.75 Å
SCOPe Domain Sequences for d1wn7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wn7a1 c.55.3.5 (A:1-347) Exonuclease domain of family B DNA polymerases {Pyrococcus kodakaraensis [TaxId: 311400]}
mildtdyitedgkpvirifkkengefkieydrtfepyfyallkddsaieevkkitaerhg
tvvtvkrvekvqkkflgrpvevwklyfthpqdvpairdkirehpavidiyeydipfakry
lidkglvpmegdeelkmlafdietlyeegeefaegpilmisyadeegarvitwknvdlpy
vdvvsteremikrflrvvkekdpdvlityngdnfdfaylkkrceklginfalgrdgsepk
iqrmgdrfavevkgrihfdlypvirrtinlptytleavyeavfgqpkekvyaeeittawe
tgenlervarysmedakvtyelgkeflpmeaqlsrligqslwdvsrs
Timeline for d1wn7a1: