Lineage for d1wn3h1 (1wn3 H:2-117)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 858616Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 858617Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) (S)
  5. 858831Family d.38.1.5: PaaI/YdiI-like [89902] (14 proteins)
  6. 858914Protein Phenylacetic acid degradation protein PaaI [89903] (2 species)
  7. 858920Species Thermus thermophilus [TaxId:274] [102909] (5 PDB entries)
  8. 858939Domain d1wn3h1: 1wn3 H:2-117 [121081]
    automatically matched to d1j1ya_
    complexed with act, cl, hxc

Details for d1wn3h1

PDB Entry: 1wn3 (more details), 2.1 Å

PDB Description: Crystal structure of TT0310 protein from Thermus thermophilus HB8
PDB Compounds: (H:) Phenylacetic acid degradation protein paaI

SCOP Domain Sequences for d1wn3h1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wn3h1 d.38.1.5 (H:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]}
rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa
valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl

SCOP Domain Coordinates for d1wn3h1:

Click to download the PDB-style file with coordinates for d1wn3h1.
(The format of our PDB-style files is described here.)

Timeline for d1wn3h1: