![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
![]() | Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (8 families) ![]() |
![]() | Family d.38.1.5: PaaI/YdiI-like [89902] (13 proteins) |
![]() | Protein Phenylacetic acid degradation protein PaaI [89903] (2 species) |
![]() | Species Thermus thermophilus [TaxId:274] [102909] (5 PDB entries) |
![]() | Domain d1wn3b1: 1wn3 B:2-117 [121075] automatically matched to d1j1ya_ complexed with act, cl, hxc |
PDB Entry: 1wn3 (more details), 2.1 Å
SCOP Domain Sequences for d1wn3b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wn3b1 d.38.1.5 (B:2-117) Phenylacetic acid degradation protein PaaI {Thermus thermophilus [TaxId: 274]} rdpfmealglkvlhlapgeavvagevradhlnlhgtahggflyaladsafalasntrgpa valscrmdyfrplgagarvearavevnlsrrtatyrvevvsegklvalftgtvfrl
Timeline for d1wn3b1: