SCOP 1.73: Domain d1wmqb1: 1wmq B:5-148

Lineage for d1wmqb1 (1wmq B:5-148)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.275: Hut operon positive regulatory protein HutP [111063] (1 superfamily)
   alpha(2)-beta-alpha(2)-beta(3); 3 layers: a/b/a; antiparallel beta-sheet: order 1234

4. Superfamily d.275.1: Hut operon positive regulatory protein HutP [111064] (1 family)

5. Family d.275.1.1: Hut operon positive regulatory protein HutP [111065] (1 protein)

6. Protein Hut operon positive regulatory protein HutP [111066] (1 species)
   an RNA-binding antitermination protein

7. Species Bacillus subtilis [TaxId:1423] [111067] (10 PDB entries)

8. Domain d1wmqb1: 1wmq B:5-148 [121069]
   automatically matched to d1veab_
   complexed with his, mg; mutant

Details for d1wmqb1

PDB Entry: 1wmq, 1.6 Å

PDB Description: structure of the hutp antitermination complex bound to a single stranded region of hut mrna

PDB Compounds: (B:) Hut operon positive regulatory protein

SCOP Domain Sequences for d1wmqb1:

Sequence, based on SEQRES records:

>d1wmqb1 d.275.1.1 (B:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllneaeestqveelerdgwkvclgkvgsmdahkviaaietaskksgvi
qsegyreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavs
lygtigapikglehetfgvginhi

Sequence, based on observed residues (ATOM records):

>d1wmqb1 d.275.1.1 (B:5-148) Hut operon positive regulatory protein HutP {Bacillus subtilis [TaxId: 1423]}
kerrigrlsvllllnetqveelerdgwkvclgkvgsmdahkviaaietaskksgviqseg
yreshalyhatmealhgvtrgemllgsllrtvglrfavlrgnpyeseaegdwiavslygt
igapikglehetfgvginhi

Timeline for d1wmqb1:

• d1wmqb1 is new in SCOP 1.73
  
• d1wmqb1 appears in SCOP 1.75
  
• d1wmqb1 appears in the current release, SCOPe 2.08, called d1wmqb_