Lineage for d1wmpb3 (1wmp B:97-211)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 855301Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 855401Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 855402Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 855403Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 855404Species Arthrobacter globiformis [TaxId:1665] [54421] (39 PDB entries)
    Uniprot P46881 9-628
  8. 855494Domain d1wmpb3: 1wmp B:97-211 [121067]
    Other proteins in same PDB: d1wmpa1, d1wmpb1
    automatically matched to d1av4_3
    complexed with co

Details for d1wmpb3

PDB Entry: 1wmp (more details), 2 Å

PDB Description: Crystal structure of amine oxidase complexed with cobalt ion
PDB Compounds: (B:) phenylethylamine oxidase

SCOP Domain Sequences for d1wmpb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmpb3 d.17.2.1 (B:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1wmpb3:

Click to download the PDB-style file with coordinates for d1wmpb3.
(The format of our PDB-style files is described here.)

Timeline for d1wmpb3: