![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) ![]() |
![]() | Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins) duplication: contains two domains of this fold |
![]() | Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species) |
![]() | Species Arthrobacter globiformis [TaxId:1665] [54421] (34 PDB entries) |
![]() | Domain d1wmpb2: 1wmp B:9-96 [121066] Other proteins in same PDB: d1wmpa1, d1wmpb1 automatically matched to d1av4_2 complexed with co |
PDB Entry: 1wmp (more details), 2 Å
SCOP Domain Sequences for d1wmpb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wmpb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]} aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs garpqevtvsvtngtvisaveldtaatg
Timeline for d1wmpb2: