Lineage for d1wmpa3 (1wmp A:97-211)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718735Superfamily d.17.2: Amine oxidase N-terminal region [54416] (1 family) (S)
  5. 718736Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
    duplication: contains two domains of this fold
  6. 718737Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)
  7. 718738Species Arthrobacter globiformis [TaxId:1665] [54421] (34 PDB entries)
  8. 718796Domain d1wmpa3: 1wmp A:97-211 [121064]
    Other proteins in same PDB: d1wmpa1, d1wmpb1
    automatically matched to d1av4_3
    complexed with co

Details for d1wmpa3

PDB Entry: 1wmp (more details), 2 Å

PDB Description: Crystal structure of amine oxidase complexed with cobalt ion
PDB Compounds: (A:) phenylethylamine oxidase

SCOP Domain Sequences for d1wmpa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmpa3 d.17.2.1 (A:97-211) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
elpvleeefevveqllatderwlkalaarnldvskvrvaplsagvfeyaeergrrilrgl
afvqdfpedsawahpvdglvayvdvvskevtrvidtgvfpvpaehgnytdpeltg

SCOP Domain Coordinates for d1wmpa3:

Click to download the PDB-style file with coordinates for d1wmpa3.
(The format of our PDB-style files is described here.)

Timeline for d1wmpa3: