SCOPe 2.07: Domain d1wmma1: 1wmm A:1-145

Lineage for d1wmma1 (1wmm A:1-145)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.122: PUA domain-like [88696] (1 superfamily)
   pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other

4. Superfamily b.122.1: PUA domain-like [88697] (14 families)

5. Family b.122.1.8: Atu2648/PH1033-like [141703] (7 proteins)
   Pfam PF01878; DUF55

6. Protein Hypothetical protein PH1033 [141706] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [141707] (3 PDB entries)
   Uniprot O58764 1-145

8. Domain d1wmma1: 1wmm A:1-145 [121049]

Details for d1wmma1

PDB Entry: 1wmm, 2.2 Å

PDB Description: Crystal structure of PH1033 from Pyrococcus horikoshii Ot3

PDB Compounds: (A:) Hypothetical UPF0310 protein PH1033

SCOPe Domain Sequences for d1wmma1:

Sequence, based on SEQRES records:

>d1wmma1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkphrggketypyrvkikpikigeinfkplindlkfiknkkrw
smhffgkamrelpeedyklieklll

Sequence, based on observed residues (ATOM records):

>d1wmma1 b.122.1.8 (A:1-145) Hypothetical protein PH1033 {Pyrococcus horikoshii [TaxId: 53953]}
mtywicitnrenwevikrhnvwgvpkkhkntlsrvkpgdklviyvrqekdkegnllepki
vgiyevtsepyvdfsrifkpggketypyrvkikpikigeinfkplindlkfiknkkrwsm
hffgkamrelpeedyklieklll

Timeline for d1wmma1:

• d1wmma1 first appeared in SCOP 1.73
  
• d1wmma1 appears in SCOPe 2.06
  
• d1wmma1 appears in the current release, SCOPe 2.08