Lineage for d1wmid_ (1wmi D:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016286Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
  4. 2016585Superfamily a.137.13: RelB-like [141004] (2 families) (S)
    wraps around RelE subunit
  5. 2016590Family a.137.13.0: automated matches [191497] (1 protein)
    not a true family
  6. 2016591Protein automated matches [190810] (1 species)
    not a true protein
  7. 2016592Species Pyrococcus horikoshii OT3 [TaxId:70601] [188082] (1 PDB entry)
  8. 2016593Domain d1wmid_: 1wmi D: [121048]
    Other proteins in same PDB: d1wmia1, d1wmib1, d1wmic_
    automated match to d1wmib1

Details for d1wmid_

PDB Entry: 1wmi (more details), 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3
PDB Compounds: (D:) hypothetical protein PHS014

SCOPe Domain Sequences for d1wmid_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wmid_ a.137.13.0 (D:) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]}
gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe
d

SCOPe Domain Coordinates for d1wmid_:

Click to download the PDB-style file with coordinates for d1wmid_.
(The format of our PDB-style files is described here.)

Timeline for d1wmid_: