SCOPe 2.01: Domain d1wmib1: 1wmi B:7-67

Lineage for d1wmib1 (1wmi B:7-67)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.13: RelB-like [141004] (2 families)
   wraps around RelE subunit

5. Family a.137.13.1: RelB-like [141005] (1 protein)

6. Protein Hypothetical protein PHS014 [141006] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [141007] (1 PDB entry)
   Uniprot O73967 7-67

8. Domain d1wmib1: 1wmi B:7-67 [121046]
   Other proteins in same PDB: d1wmia1, d1wmic_, d1wmid_

Details for d1wmib1

PDB Entry: 1wmi, 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3

PDB Compounds: (B:) hypothetical protein PHS014

SCOPe Domain Sequences for d1wmib1:

Sequence; same for both SEQRES and ATOM records:

>d1wmib1 a.137.13.1 (B:7-67) Hypothetical protein PHS014 {Pyrococcus horikoshii [TaxId: 53953]}
gdvlkelerlkveiqrleamlmpeerdediteeeiaellelardedpenwidaeelpepe
d

Timeline for d1wmib1:

• d1wmib1 first appeared in SCOP 1.73
  
• d1wmib1 appears in SCOP 1.75
  
• d1wmib1 appears in SCOPe 2.02
  
• d1wmib1 appears in the current release, SCOPe 2.08