SCOPe 2.01: Domain d1wmia1: 1wmi A:1-88

Lineage for d1wmia1 (1wmi A:1-88)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.298: RelE-like [143010] (1 superfamily)
   beta-alpha(2)-beta(4), 2 layers; a/b, antiparallel beta-sheet; order 15432

4. Superfamily d.298.1: RelE-like [143011] (3 families)
   Toxin component of plasmid stabilisation system

5. Family d.298.1.2: RelE-like [143015] (3 proteins)
   Pfam PF05016

6. Protein Hypothetical protein PHS013 [143016] (1 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143017] (1 PDB entry)
   Uniprot O73966 1-88

8. Domain d1wmia1: 1wmi A:1-88 [121045]
   Other proteins in same PDB: d1wmib1, d1wmic_, d1wmid_

Details for d1wmia1

PDB Entry: 1wmi, 2.3 Å

PDB Description: Crystal structure of archaeal RelE-RelB complex from Pyrococcus horikoshii OT3

PDB Compounds: (A:) hypothetical protein PHS013

SCOPe Domain Sequences for d1wmia1:

Sequence; same for both SEQRES and ATOM records:

>d1wmia1 d.298.1.2 (A:1-88) Hypothetical protein PHS013 {Pyrococcus horikoshii [TaxId: 53953]}
mtyrvkihkqvvkalqslpkahyrrflefrdileyepvprekfdviklegtgdldlyrar
lgdyrviysvnwkdkvikilklkprgra

Timeline for d1wmia1:

• d1wmia1 first appeared in SCOP 1.73
  
• d1wmia1 appears in SCOP 1.75
  
• d1wmia1 appears in SCOPe 2.02
  
• d1wmia1 appears in the current release, SCOPe 2.08