SCOPe 2.08: Domain d1wmbb_: 1wmb B:

Lineage for d1wmbb_ (1wmb B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
   also known as short-chain dehydrogenases and SDR family
   parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
   has additional subdomain(s) that are not in the common domain
   

6. Protein automated matches [190085] (59 species)
   not a true protein

7. Species Pseudomonas fragi [TaxId:296] [188080] (6 PDB entries)

8. Domain d1wmbb_: 1wmb B: [121044]
   Other proteins in same PDB: d1wmba1
   automated match to d1wmba1
   complexed with cac, mg

Details for d1wmbb_

PDB Entry: 1wmb, 2 Å

PDB Description: Crystal structure of NAD dependent D-3-hydroxybutylate dehydrogenase

PDB Compounds: (B:) D(-)-3-hydroxybutyrate dehydrogenase

SCOPe Domain Sequences for d1wmbb_:

Sequence; same for both SEQRES and ATOM records:

>d1wmbb_ c.2.1.2 (B:) automated matches {Pseudomonas fragi [TaxId: 296]}
mlkgkvavvtgstsgiglgiatalaaqgadivlngfgdaaeiekvraglaaqhgvkvlyd
gadlskgeavrglvdnavrqmgridilvnnagiqhtaliedfptekwdailalnlsavfh
gtaaalphmkkqgfgriiniasahglvasanksayvaakhgvvgftkvtaletagqgita
naicpgwvrtplvekqisalaekngvdqetaarellsekqpslqfvtpeqlggtavflas
daaaqitgttvsvdggwtar

Timeline for d1wmbb_:

• d1wmbb_ first appeared in SCOP 1.73, called d1wmbb1
  
• d1wmbb_ appears in SCOPe 2.07