Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.96: T-fold [55619] (2 superfamilies) beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234 tunnel-shaped: its known members form wide oligomeric barrels different sizes |
Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (4 families) bind purine or pterin in topologically similar sites between subunits |
Family d.96.1.1: GTP cyclohydrolase I [55621] (1 protein) |
Protein GTP cyclohydrolase I [55622] (4 species) beta-sheets of five subunits form a barrel, closed: n=20, S=20 |
Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries) |
Domain d1wm9e1: 1wm9 E:33-216 [121041] automatically matched to 1WM9 A:32-216 complexed with zn |
PDB Entry: 1wm9 (more details), 2.2 Å
SCOP Domain Sequences for d1wm9e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1wm9e1 d.96.1.1 (E:33-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]} vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl shlr
Timeline for d1wm9e1:
View in 3D Domains from other chains: (mouse over for more information) d1wm9a1, d1wm9b1, d1wm9c1, d1wm9d1 |