Lineage for d1wm9d_ (1wm9 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2207295Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2207296Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2207297Family d.96.1.1: GTP cyclohydrolase I [55621] (2 proteins)
  6. 2207298Protein GTP cyclohydrolase I [55622] (4 species)
    beta-sheets of five subunits form a barrel, closed: n=20, S=20
  7. 2207442Species Thermus thermophilus [TaxId:274] [143627] (3 PDB entries)
    Uniprot Q5SH52 32-216
  8. 2207456Domain d1wm9d_: 1wm9 D: [121040]
    automated match to d1wm9a1
    complexed with zn

Details for d1wm9d_

PDB Entry: 1wm9 (more details), 2.2 Å

PDB Description: Structure of GTP cyclohydrolase I from Thermus thermophilus HB8
PDB Compounds: (D:) GTP cyclohydrolase I

SCOPe Domain Sequences for d1wm9d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wm9d_ d.96.1.1 (D:) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]}
evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
lshlr

SCOPe Domain Coordinates for d1wm9d_:

Click to download the PDB-style file with coordinates for d1wm9d_.
(The format of our PDB-style files is described here.)

Timeline for d1wm9d_: